Sökresultat

In 2009, a nationwide initiative was established in order to lead and develop world-leading research in Sweden. Lund University received strategic research funding from the Swedish Foundation for Stategic Research and the Swedish Government for 12 strategic research areas (SRAs) of excellence. Of these 12 SRAs, StemTherapy (the strategic research area for Stem Cells and Regenerative Medicine) cont

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

Forskningen bedrivs vid avdelningen för infektionsmedicin på BMC i nära samarbete med avdelningen för reumatologi och fokuserar kring nya mekanismer hos neutrofiler (en slags vita blodkroppar) som kan förklara eller prognosticera infektionssjukdom eller infektionskänslighet. Projekten drivs både som translationella studier där vi försöker förklara mekanismerna varför infektionssjukdom uppträder hoOur research is conducted at the division of infection medicine at BMC in close collaboration with the division of rheumatology. The research is focused on new neutrophil mechanisms that can explain or prognosticate infectious diseases. The approach to the projects is either translational, where we try to explain why certain individuals turn ill due to infections, or more clinically focused, where

SDE at Lund University conducts research on the development of new tools, languages, and methods for software development. Example areas include compilers, program analysis, domain-specific languages and tools, meta-programming tools, integrated development environments, code review tools, adaptive developer tools, agile methodology, software architecture and design, pervasive systems, internet-of

Bertil Johansson är forskargruppsledare för forskargruppenBertil Johansson is Research Group Leader for this research group

The Urban Systems and Dynamics group, led by Prof. Nik, advances the boundaries of Building Physics to explore the complex interactions between buildings, urban systems, and climate. Our research focuses on designing and optimizing strategies for buildings and urban systems (with a big focus on energy systems) that drive the sustainable urban transition and enhance the built environment's resilien

20191022 Inresande forskningspraktikanter (grund- eller masterstudenter) Den internationella kommittén vid Institutionen för psykologi har beslutat om riktlinjer för att skapa bra förutsättningar för ett ömsesidigt givande forskningssamarbete mellan inkommande forskningspraktikanter samt ansvariga forskare. Då du som forskare blir kontaktad av internationella studenter som önskar delta i ett forsk

https://www.psy.lu.se/sites/psy.lu.se/files/inresande_forskningspraktikanter.pdf - 2026-05-30

Uppsatsen har undersökt huruvida spelföretaget Star Stable Entertainment AB marknadsföring av virtuella valutor och produkter till barn bryter mot EU:s konsumentskyddslagstiftning i ljuset av Sveriges Konsumenters anmälan mot företaget. Uppsatsen har även diskuterat om direktivet om otillbörliga affärs-metoder är anpassat för den digitala miljön med hänsyn till kommissionens aktuella fitness checkThe essay analyses whether the gaming company Star Stable Entertainment AB´s marketing of virtual currencies and other virtual products against chil-dren violates EU consumer law, considering the Swedish Consumers Associ-ation’s complaint against the company. The paper also discusses whether the Unfair Commercial Practice Directive (UCPD) is fit for the digital environ-ment, given the European Com

Monte Carlo Calculations in Nuclear Medicine: Applications in Diagnostic Imaging - First edition Eds. M Ljungberg; S-E Strand, Lund University Hospital, Sweden; M A King, University of Massachussetts Medical School, Worcester, USA Covers the applications of Monte Carlo calculations (MC) in nuclear medicine from first principles, to the current computer applications. Written for nuclear medicine ph

https://www.msf.lu.se/research/simind-monte-carlo-program/literature - 2026-05-29

During δ-aminolevulinic acid (ALA) based Interstitial Photodynamic Therapy (IPDT) a high light fluence rate is present close to the source fibers. This might induce an unintentional tissue temperature increase of importance for the treatment outcome. In a previous study, we have observed, that the absorption in the tissue increases during the treatment. A system to measure the local tissue tempera

Preliminärt schema höstterminen 2022 Kurs: Miljövetenskap: Analys och metodik (MVEN13) Kursansvarig: Ullrika Sahlin US Lärare: Björn Klatt BK Anna Lindgren AL Charlotta Turner CT Lokaler: Green Room, Biologihuset, Sölvegatan 35, Lund Litteratur: Litteratur för kursen är material som finns tillgänglig i digital form på kursens lärplattform Canvas och universitetets bibliotek. Studieteknik: Läs om s

https://www.cec.lu.se/sv/sites/cec.lu.se.sv/files/2022-07/MVEN13%20HT22%20p1_ver4_2.pdf - 2026-05-30

MILJÖVETENSKAP Preliminärt schema 171018 Kurs: MVET01 Kursansvarig: Charlotte Leire Lärare: Charlotte Leire, Julia Nussholz, Katherine Whalen, Philip Peck och Torbjörn Brorson. Gästföreläsare: Åke Thidell, Christina Windmark, Martin Kurdve, Murat Mirata, Anna Bruun Månsson, Lars Strupeit och Alexander Lidgren. Lokaler: Ekologihuset och till viss del IIIEE Litteratur: Se läslistor på LUVIT Studiete

https://www.cec.lu.se/sv/sites/cec.lu.se.sv/files/schema_mvet01_ht17_171017.pdf - 2026-05-30

Staben samordnar och utvecklar Lunds universitetets ekonomimodell, förvaltar och utvecklar de IT-system som sektionen Ekonomi ansvarar för. Samordnar och utvecklar sektionens stöd i form av utbildning, information och support. Utvecklar och ansvarar för konsolidering av universitetets totalbudget samt ekonomiska uppföljning och analys. Ger stöd och råd i budget och uppföljningsfrågor. Leder och u