Filtyp
Computer vision is on the cusp of revolutionizing several different markets through its applications. One such market is that of fitness and exercise. Advagym, Sony's connected gym solution is currently employing IoT solutions to track exercises in a gym environment. Together with Sony's R\&D Center Lund Laboratory's computer vision- and machine learning-equipped tracking system -
Prostate-specific antigen (PSA) has been the main drive for early detection of prostate cancer (PCa), including in population-based screening as in the European Randomised Study for Screening of Prostate Cancer (ERSPC). The specificity of PSA to indicate men with biopsy detectable prostate cancer can be improved by adding information obtained by new biomarkers, such as PSA isoforms. This improveme
Professorsinstallation Lunds universitet | aulan | 7 september 2012 kl 16.00 3 Förord Välkomna till den högtidliga professorsinstallationen! Ordet universitet kommer av det latinska universitas, som betyder ungefär helhet, det hela. Detta ord har samband med universus med betydelsen hel, allomfat- tande, egentligen vänd åt ett håll liksom med universum och universell. Universitas blev under högmed
https://www.lu.se/sites/www.lu.se/files/professorsinstallationsbroschyr_sep2012.pdf - 2026-07-10
Introduction Neoadjuvant therapy is the standard of care for the treatment of human epidermal growth factor receptor 2 (HER2)-positive breast cancer (BC). Studies on first-generation antibody-drug conjugates, such as trastuzumab emtansine (T-DM1), showed equal or slightly lower efficacy than chemotherapy combined with dual HER2 blockade. Trastuzumab deruxtecan (T-DXd) is a next-generation conjugat
Adsorption isotherms taken at temperatures ranging from 20 to 77 K show a large pore volume and surface area of 980 m2 g-1 for the physical adsorption of molecular hydrogen on MCM-41. The adsorbed hydrogen behaves more like a solid than a liquid and isosteric heats of adsorption reveal a heterogenous surface. The evaporation behaviour of the adsorbed hydrogen indicates that the hexagonally packed
In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]). In doing so, smooth mesoporous nanoparticles were compared to virus-like mesoporous nanoparticles, characterized by a "spiky"external surface, as well as to nonporous silica nanoparticles. For this, we employed a combinat
Course analysis GeoN06, autumn 2021 Course leader: Anne Birgitte Nielsen GeoN06 is a master’s level course open to students from geology, archaeology, geography, biology and related subjects. The course is built around a project work running through the course and a series of lectures by different teachers, with different specializations within paleoecology and related methodologies. A course eval
https://www.geology.lu.se/sites/geology.lu.se/files/2022-03/GeoN06%20Course%20analysis%20HT%202021.pdf - 2026-07-10
A newsletter is a regularly distributed publication, usually via email, which deals with topics of interest to the newsletter’s subscribers. Sometimes, there is too much confidence in what can be achieved with newsletters. It may seem efficient to send out an email packed with information to many people, when in fact more, and sometimes other, forms of communication may be needed to reach out. So
A skills development initiative carried out by IAC. In this 3 day-training, we will explore spatial audio at an introductory level. It is aimed at those who have experience in working with sound art and want to explore the tools available for creating Spatial Audio pieces. The focus will primarily be on binaural headphone listening with the potential for presentation through larger speaker systems
https://www.iac.lu.se/spatial-audio-training - 2026-07-09
https://www.climatefutures.lu.se/citizens - 2026-07-09
instagram – Vetenskap och Hälsa Hoppa till innehåll Vetenskap och hälsa Populärvetenskapligt om medicinsk forskning i Skåne Teman Podd Tidskrift Prenumerera Om webbplatsen Kontakt Sök Sök Etikett: instagram Pojkar och flickor vid skärmar: Kan påverkas negativt men på olika sätt 2024-11-15 Tiden de tillbringar vid en skärm är ungefär lika lång. Skillnaden ligger främst i vad de gör vid skärmen. Poj
https://www.vetenskaphalsa.se/tag/instagram/ - 2026-07-10
The bending energy of the lipid membrane is central to biological processes involving vesicles, such as endocytosis and exocytosis. To illustrate the role of bending energy in these processes, we study the response of single-component giant unilamellar vesicles (GUVs) subjected to external osmotic stress by glucose addition. For osmotic pressures exceeding 0.15 atm, an abrupt shape change from sph
LUCRIS consists of several modules. All added information can be linked to show the full research context. How to use LUCRISYou access LUCRIS by logging into the database with your Lucat ID. Once logged in, you can enter information into the different modules.What to enterIn general, only add information related to your research. Exceptions include information you might want to include in your CV,
https://www.staff.lu.se/research-and-education/research-support/lucris/use-lucris - 2026-07-10
Evaluation form for Internet GIS Course Answer Count: 30 What did you like most in the course? Why? What did you like most in the course? Why? The part were we learned to create a mapclient with openlayers and geoserver. For me, it was all new to be able to use HTML and websites, so that was great. Also, I really got a lot out of the project. The WMS in Geoserver using Openlayers Figuring out t
https://www.nateko.lu.se/sv/sites/nateko.lu.se.sv/files/gisn09_utvardering.pdf - 2026-07-10
Electron-lattice interactions play a large role in determining physical properties of crystalline solids, such as electrical resistance and superconductivity. Properties like these are not only of theoretical interest, but also of practical importance when designing new materials. A key quantity describing these interactions is the electron-phonon coupling, which links atomic displacement to chang
I enlighet med svensk bevisrätt är principen om den fria bevisprövningen starkt dominerande vid prövning i domstol. Principen innebär att det åligger parterna i ett mål att inför domstolen åberopa all den bevisning som finns att tillgå. Det åligger sedan domstolen att fritt, och utan större begränsningar, pröva och värdera den bevisning som parterna lagt fram. I motsats till den fria svenska modelAccording to Swedish law, the Principle of the Free Presentation of Evidence dominates the judicial process in many ways. The meaning of the principle is that the parties in a trial decide what evidence should be admitted. When that is done it is up to the court to weigh the value of that very evidence, in accordance with the principle that gives the courts the ability of free valuation of all adm
Popular Abstract in English The potential of coconut proteins as food ingredients was studied with the aim of evaluating how plant proteins, in particular those from coconut, could find industrial applications and compete with proteins of animal origin based on meat, fish, milk or eggs. Three research directions were chosen for investigation, to evaluate how coconut proteins would perform in each At present, coconut proteins are discarded as a waste product by the coconut oil industry. If the range of applications of coconut proteins is to be expanded, their potential functionalities should be investigated. Emulsions and gels are of the greatest interest in food industry. Today the dry processing of copra at elevated temperatures is used to optimize the oil recovery. The functionalities o
Uppsatsen behandlar den fria rörligheten för varor i relation till det svenska alkoholmonopolet samt hur Systembolagets framtid ser ut om gårdsförsäljning införs i Sverige. Art 34, art 36 och art 37 FEUF är tre fördragsbestämmelser som har varit av relevans för uppsatsens undersökning. Frågeställningarna som uppsatsen syftar till att besvara är för det första hur det svenska alkoholmonopolet förhåThe essay addresses the free movement of goods in relation to the Swedish alcohol monopoly and how Systembolaget's future looks if on-farm sales are introduced in Sweden. Art 34, art 36 and art 37 TFEU are three treaty provisions that have been relevant to the essay's examination. The questions that the essay aims to answer are, firstly, how the Swedish alcohol monopoly relates to the prov
Photo Exhibition 4 - 15 February 2019 The Chinese New Year celebrates the beginning of the new year according to the lunar calendar. It is a time to return to one's hometown, reunite with family, honour ancestors and worship deities. Many traditional rituals are still practiced at the same time as new modern ways influence how one celebrate and share this event. To send well-wishes via social medi
https://www.ace.lu.se/activities/selected-past-events/chinese-new-year-through-photo-app - 2026-07-09
