Sökresultat

Local stellar motions are expected, and have been shown, to include signatures of the Galaxy’s past dynamical evolution. These are typically divided into the disc, which shows the dynamical effects of spiral arms and the bar, and the stellar halo, with structures thought to be debris from past mergers. We use Gaia Data Release 3 to select large samples of these populations without limiting them to

Context dependence arises when ecological relationships vary with the conditions under which they are observed. Context dependence of interactions involving parasites is poorly known, even if it is key to understanding host–parasite relationships and food web dynamics. This paper investigates to which extent predation pressure on an avian ectoparasite (Carnus hemapterus) is context-dependent. Base

Introduction: Previous studies show that both staff and patients describe patient participation as a challenge in forensic psychiatry. One reason may be that the forensic psychiatric process is difficult to understand and is experienced as being slow and complex. The proceedings in an administrative court are a core element in forensic psychiatric care as it constitutes the legal authority that le

Context. The population of strongly irradiated Jupiter-sized planets has no equivalent in the Solar System. It is characterised by strongly bloated atmospheres and large atmospheric scale heights. Recent space-based observations of SO2 photochemistry have demonstrated the knowledge that can be gained about Earth's uniqueness from detailed atmospheric studies of these unusual planets. Aims. Here we

Among thermal improvements of external walls in heritage buildings, interior insulation of external walls might be the only option. However, interior insulation is associated with several risks of damage due to the diminishment of the hygrothermal performance of the existing wall. This project aims to assess the impact of available solutions for interior insulation through field measurements and h

Objective: Changes observed during adult GH deficiency (GHD) are most often reversed with the administration of recombinant human GH (rhGH). To avoid daily injections, a long-acting GH molecule has been obtained by covalent binding of polyethylene glycol (PEG) with rhGH (PEG-GH), allowing weekly s.c. injections. This study was designed to assess its efficacy and safety, in adult GHD subjects.Desig

We report the discovery of two warm sub-Neptunes transiting the bright (G = 9.5 mag) K-dwarf HD 15906 (TOI 461, TIC 4646810). This star was observed by the Transiting Exoplanet Survey Satellite (TESS) in sectors 4 and 31, revealing two small transiting planets. The inner planet, HD 15906 b, was detected with an unambiguous period but the outer planet, HD 15906 c, showed only two transits separated

Galectin-3 is a beta-galactoside-binding mammalian lectin that is one of a 15-member galectin family that can bind several cell surface glycoproteins via its carbohydrate recognition domain (CRD). As a result, it can influence a range of cellular processes including cell activation, adhesion and apoptosis. Galectin-3 has been implicated in various diseases, including fibrotic disorders and cancer,

Three-dimensional city models are increasingly being used for analyses and simulations. To enable such applications, it is necessary to standardise semantically richer city models and, in some cases, to connect the models with external data sources. In this study, we describe the development of a new Swedish specification for 3D city models, denoted as 3CIM, which is a joint effort between the thr

The purpose of this contribution is to present a survey of the recent developments in constructing composite science and technology (S&T) indicators on a national level as well as new evidence of the variability of such S&T indicators which opens the gateway to "country-tuning". It has become standard practice to combine several indicators for science, technology, and innovation to form co

Expression of the cysteine proteinase cathepsin B and its physiological inhibitor cystatin C was analyzed in vitro in I human fibrosarcoma and 4 human colon carcinoma cell lines. Cystatin C antigen as well as cathepsin B activity were detected in the conditioned media of the 5 cell lines. The corresponding cell extracts expressed high levels of cathepsin B activity, whereas only trace amounts of c

A few years ago, the legality of Operation Enduring Freedom (OEF) was a topic much discussed in the international legal literature. This article approaches the problem from a new angle. Rather than investigating the relevant issue of legal substance – whether or not OEF was ever consistent with international law – the article focuses attention on the general scholarly performance in dealing with t

Using immunofluorescence and electron microscopy we have studied the localization of wild-type and mutant c-myc proteins transiently expressed in CV-1 cells. In agreement with our previous observations, wild-type c-myc protein accumulated in large amorphous globules in the nucleus. All mutant proteins tested accumulated in the nucleus as well, but gave rise to morphologically different inclusion b

The ultrastructure of the specialized nauplius eye of three species of the copepod genusSapphirina was investigated. The gross morphology described earlier (Elofsson, 1966a) was confirmed. The ventral cup is covered by a red pigment and the lateral cups by a red and a black pigment. The ultrastructural configuration of the pigment granules was found to differ in the two kinds of pigment cells. The

Bananas are widely consumed fruits with over 140 metric tons produced annually. As much as 336 metric tons of banana pseudo-stems, sheaths, piths, peels and leaves are produced annually. These wastes are usually discarded via composting, aerobic decomposition, incinerated or simply allowed to rot in the fields. However, these treatments may cause serious environmental and ecological problems. Mea

Background Patch test reactivity to nickel varies over time. To what extent this variation is associated with fluctuations in the T-cell reactivity to nickel is not known. Objectives Our aim was to investigate the relationship between variation over time in the patch test and the systemic T-cell reactivity to nickel. Methods Patients (n = 15) with a history of contact allergy to nickel were subjec

Hexahydrophthalic anhydride (HHPA) is a highly sensitizing industrial chemical that is known to covalently bind to endogenous proteins. The aim of this study was to determine the binding sites of HHPA to human serum albumin (HSA). Conjugates between HSA and HHPA, at two different molar ratios, were synthesized under physiological conditions. The conjugates were digested with trypsin and Pronase E

Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieve