Search results

7 May 2025 12:00 to 13:15 | Lecture/talk Join in for a lunch walk when our skilled and experienced guide takes us on a guided tour in the historical parts of Lund and tells us odd stories about ghosts and murderers from bygone times. Don't miss this semester's last Wellness Weeks event when you get to listen to all kind of odd stories about people and places in Lund down the centuries, and most of

https://www.lusem.lu.se/calendar/guided-tour-historical-lund-0 - 2026-07-07

Popular Abstract in English The potential of coconut proteins as food ingredients was studied with the aim of evaluating how plant proteins, in particular those from coconut, could find industrial applications and compete with proteins of animal origin based on meat, fish, milk or eggs. Three research directions were chosen for investigation, to evaluate how coconut proteins would perform in each At present, coconut proteins are discarded as a waste product by the coconut oil industry. If the range of applications of coconut proteins is to be expanded, their potential functionalities should be investigated. Emulsions and gels are of the greatest interest in food industry. Today the dry processing of copra at elevated temperatures is used to optimize the oil recovery. The functionalities o

In 2017 the Swedish government takes the decision that conscription will be reactivated after eight years of sleep. Major system changes like this need time to find their path so they are able to produce. Therefore, several questions are raised ahead of the reactivation of the conscription. This study answers to the question why the conscription was taken back in service. The answer and driving fo

The area of autonomous parking attracts a great deal of attention from the research community and the automobile industry. Research has showed that many robotic navigation systems fail to deliver the performance and flexibility of animal navigation techniques, even though they are both mathematically and technologically complex. Biomimetic robotic research, i.e., research that tries to mimic biolo

Apolipoprotein M (apoM) in human plasma is mainly associated with HDL. A retained signal peptide anchors apoM to the lipoproteins. To investigate the role of the signal peptide in the transfer of apoM from the synthesizing cell to the lipoproteins, wildtype apoM cDNA and the Q(22)A mutant, introducing a signal peptidase cleavage site, were used to stably transfect HEK293 cells, which intrinsically

Computer vision is on the cusp of revolutionizing several different markets through its applications. One such market is that of fitness and exercise. Advagym, Sony's connected gym solution is currently employing IoT solutions to track exercises in a gym environment. Together with Sony's R\&D Center Lund Laboratory's computer vision- and machine learning-equipped tracking system -

This page provides information and support regarding risky and harmful use of alcohol, other drugs and gambling. Content on this page:IntroductionTest your drinking habits anonymous onlineIf you have a problem with risky or harmful useIf you have concerns about a colleagueWould you like to find out more about risky and harmful use?Definitions of risky and harmful useIntroductionAs well as alcohol,

https://www.staff.lu.se/employment/work-environment-and-health/health-and-wellness/risky-and-harmful-use-alcohol-other-drugs-and-gambling - 2026-07-07

Lärare Kontaktinformation E-post: wieslawa [dot] szymczynska [at] mhm [dot] lu [dot] seOrganisation Lärare (Musikhögskolan) WebbplatsWieslawa Szymczynskas profil i Lunds universitets forskningsportalUniversitetsadjunkt i violinWIESKA SZYMCZYNSKA är född och uppvuxen i Polen. Studerade i sin hemstad Poznan samt i Moskva. Hon var med att bilda en studentkammarorkester i Poznan, som med åren blev Pol

https://www.mhm.lu.se/wieslawa-szymczynska - 2026-07-07

Prostate-specific antigen (PSA) has been the main drive for early detection of prostate cancer (PCa), including in population-based screening as in the European Randomised Study for Screening of Prostate Cancer (ERSPC). The specificity of PSA to indicate men with biopsy detectable prostate cancer can be improved by adding information obtained by new biomarkers, such as PSA isoforms. This improveme

Hej ! Välkommen till det Beteendevetenskapliga programmet vid Lunds Universitet! Vi som skrivit detta brev heter Sofia Fredholm och Markus Nordbring. Vi är Sexmästare i programföreningen BiL (Beteendevetare i Lund). BiL är föreningen för dig som läser beteendevetenskap i Lund. Genom att vara medlem i BiL har du möjlighet att gå på roliga sittningar, delta i sportevenemang, gå på gästföreläsningar

https://www.psy.lu.se/sites/psy.lu.se/files/valkomstbrev2018_fran_bil.docx - 2026-07-07

1 December 2026 09:00 to 2 December 2026 17:00 | Conference Two days of workshops, seminars, debates and the exchange of experience on the theme of artificial intelligence. The event is aimed at teachers, researchers and administrative staff at Lund University. Over the course of the two days, we will explore the opportunities and challenges of AI in academia – from practical applications to ethic

https://www.staff.lu.se/calendar/ai-days-2026-ai-our-time-opportunities-challenges-and-future - 2026-07-06

Ny kunskap om njurskada vid EHEC – Vetenskap och Hälsa Hoppa till innehåll Vetenskap och hälsa Populärvetenskapligt om medicinsk forskning i Skåne Teman Podd Tidskrift Prenumerera Om webbplatsen Kontakt Sök Sök Ny kunskap om njurskada vid EHEC 2014-12-09 ⚠️ Den här artikeln är mer än 5 år gammal. Nya forskningsrön kan ha tillkommit. Varje sommar hör vi om nya fall av EHEC. Ofta är det små barn som

https://www.vetenskaphalsa.se/ny-kunskap-om-njurskada-vid-ehec/ - 2026-07-07

20 May 2026 17:00 to 19:00 | Workshop We are hosting a workshop consisting of a brief introduction and start-up guide for the wonderful world of 3D-printing. We will show you how you use the 3d printers in X-Lab and the process of preparing a 3D model on your computer to be able to print it out. If we have time you will also be able to start your own prints during the workshop session to be collec

https://www.x-lab.lth.se/calendar/x-lab-3d-printing-workshop - 2026-07-07

We strive to make IAC’s premises accessible to all. If you have any questions or suggestions, please feel free to contact us!IAC is located on the 4th floor of the old Mazetti chocolate factory, and is accessible by stairs or lift.People with reduced mobility are advised to use the lift, which can accommodate 18 people or 1400 kg. The lift is located in the entrance hall directly opposite the entr

https://www.iac.lu.se/accessibility-iac - 2026-07-07

Adsorption isotherms taken at temperatures ranging from 20 to 77 K show a large pore volume and surface area of 980 m2 g-1 for the physical adsorption of molecular hydrogen on MCM-41. The adsorbed hydrogen behaves more like a solid than a liquid and isosteric heats of adsorption reveal a heterogenous surface. The evaporation behaviour of the adsorbed hydrogen indicates that the hexagonally packed

In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]). In doing so, smooth mesoporous nanoparticles were compared to virus-like mesoporous nanoparticles, characterized by a "spiky"external surface, as well as to nonporous silica nanoparticles. For this, we employed a combinat

Introduction Neoadjuvant therapy is the standard of care for the treatment of human epidermal growth factor receptor 2 (HER2)-positive breast cancer (BC). Studies on first-generation antibody-drug conjugates, such as trastuzumab emtansine (T-DM1), showed equal or slightly lower efficacy than chemotherapy combined with dual HER2 blockade. Trastuzumab deruxtecan (T-DXd) is a next-generation conjugat

4 March 2026 12:00 to 13:00 | Seminar MALMÖ CANCER SEMINARSWednesday March 4th at 12.00-13.00 at Room 2005/2007, 2nd floor, Målpunkt D, Inga Marie Nilssons gata 47, SUS Malmö or join Zoom: https://lu-se.zoom.us/j/66511028623 Title: “Microscopy Image Analysis and Multimodal Analytics in the Era of AI” Speaker: Jianxu ChenResearch Group Leader, AMBIOM – Analysis of Microscopic BIOMedical Images, Dep

https://www.lucc.lu.se/internal/calendar/lucc-malmo-cancer-seminars - 2026-07-07