Search results

Microsoft Word - Årsrapport 2022 FINAL utan namn.docx 1 Övervakning av fåglarnas populationsutveckling Årsrapport för 2022 Martin Green, Fredrik Haas & Åke Lindström Innehållsförteckning Summary 2 Sammanfattning 3 Inledning 4 Metoder 5 Resultat och Diskussion 10 Artkommentarer 27 Publikationer 2022 Tack 40 41 Populationstrender hos svenska fåglar 44 Populationstrender hos svenska däggdjur 85 Omsla

https://www.fageltaxering.lu.se/sites/fageltaxering.lu.se/files/2023-12/arsrapportfor2022.pdf - 2026-07-07

Popular Abstract in Swedish Om flyttningens betydelse för utbredningsmönster för arktiska fåglar Sara Henningsson Fågelflyttning är en anmärkningsvärt framgångsrik strategi som möjliggör att en större mängd individer kan försörjas genom rörelser mellan olika regioner. Inom dessa olika områden, som ofta ligger mycket långt ifrån varandra, kan fåglarna utnyttja stora säsongsmässigt tillgängliga resFlexibility as well as constraints to the evolution of migration routes has the possibility of affecting large-scale patterns of geographical ranges of animals both by facilitating, but sometimes restricting, accessibility to and colonization of new regions. This dissertation concerns the broad-scale effects migration has on the distributional patterns of birds in the Arctic. I studied the circu

Ny kunskap om njurskada vid EHEC – Vetenskap och Hälsa Hoppa till innehåll Vetenskap och hälsa Populärvetenskapligt om medicinsk forskning i Skåne Teman Podd Tidskrift Prenumerera Om webbplatsen Kontakt Sök Sök Ny kunskap om njurskada vid EHEC 2014-12-09 ⚠️ Den här artikeln är mer än 5 år gammal. Nya forskningsrön kan ha tillkommit. Varje sommar hör vi om nya fall av EHEC. Ofta är det små barn som

https://www.vetenskaphalsa.se/ny-kunskap-om-njurskada-vid-ehec/ - 2026-07-07

Professorsinstallation Lunds universitet | aulan | 7 september 2012 kl 16.00 3 Förord Välkomna till den högtidliga professorsinstallationen! Ordet universitet kommer av det latinska universitas, som betyder ungefär helhet, det hela. Detta ord har samband med universus med betydelsen hel, allomfat- tande, egentligen vänd åt ett håll liksom med universum och universell. Universitas blev under högmed

https://www.lu.se/sites/www.lu.se/files/professorsinstallationsbroschyr_sep2012.pdf - 2026-07-07

Popular Abstract in Swedish Prostata cancer är en av de vanligast förekommande cancerformerna hos män i västvärlden och den vanligaste förekommande hos män i Sverige. Årligen diagnosticeras i Sverige ungefär 6000 fall och mer än 2000 avlider. Drygt 70% av alla som drabbas är äldre än 70 år medan endast ett fåtal är yngre än 50 år. Sjukdomen ter sig mycket olika hos olika patienter. En del som drab

A newsletter is a regularly distributed publication, usually via email, which deals with topics of interest to the newsletter’s subscribers. Sometimes, there is too much confidence in what can be achieved with newsletters. It may seem efficient to send out an email packed with information to many people, when in fact more, and sometimes other, forms of communication may be needed to reach out. So

https://www.staff.lu.se/support-and-tools/communication-and-graphic-profile/press-and-news/internal-newsletters/checklist-writing-newsletters - 2026-07-05

https://www.climatefutures.lu.se/citizens - 2026-07-05

A skills development initiative carried out by IAC. In this 3 day-training, we will explore spatial audio at an introductory level. It is aimed at those who have experience in working with sound art and want to explore the tools available for creating Spatial Audio pieces. The focus will primarily be on binaural headphone listening with the potential for presentation through larger speaker systems

https://www.iac.lu.se/spatial-audio-training - 2026-07-05

LUCRIS consists of several modules. All added information can be linked to show the full research context. How to use LUCRISYou access LUCRIS by logging into the database with your Lucat ID. Once logged in, you can enter information into the different modules.What to enterIn general, only add information related to your research. Exceptions include information you might want to include in your CV,

https://www.staff.lu.se/research-and-education/research-support/lucris/use-lucris - 2026-07-06

Apolipoprotein M (apoM) in human plasma is mainly associated with HDL. A retained signal peptide anchors apoM to the lipoproteins. To investigate the role of the signal peptide in the transfer of apoM from the synthesizing cell to the lipoproteins, wildtype apoM cDNA and the Q(22)A mutant, introducing a signal peptidase cleavage site, were used to stably transfect HEK293 cells, which intrinsically

In 2017 the Swedish government takes the decision that conscription will be reactivated after eight years of sleep. Major system changes like this need time to find their path so they are able to produce. Therefore, several questions are raised ahead of the reactivation of the conscription. This study answers to the question why the conscription was taken back in service. The answer and driving fo

The area of autonomous parking attracts a great deal of attention from the research community and the automobile industry. Research has showed that many robotic navigation systems fail to deliver the performance and flexibility of animal navigation techniques, even though they are both mathematically and technologically complex. Biomimetic robotic research, i.e., research that tries to mimic biolo

Evaluation form for Internet GIS Course Answer Count: 30 What did you like most in the course? Why?    What did you like most in the course? Why? The part were we learned to create a mapclient with openlayers and geoserver. For me, it was all new to be able to use HTML and websites, so that was great. Also, I really got a lot out of the project. The WMS in Geoserver using Openlayers Figuring out t

https://www.nateko.lu.se/sv/sites/nateko.lu.se.sv/files/gisn09_utvardering.pdf - 2026-07-07

Creating motivation in language classrooms: How can we put practice into theory? Alastair Henry SKÄL October 4, 2024 Overview • In L2 Motivation research, 3 disconnects that (i) diminish the potential of research, and (ii) can leave practice unsupported • Ways in which Practice and Theory can be more productively aligned Disconnect #1: Different interests “[T]he language teaching and research prof

https://www.uvet.lu.se/fileadmin/user_upload/ahu/skal_2024_Alastair_Henry.pdf - 2026-07-06

Computer vision is on the cusp of revolutionizing several different markets through its applications. One such market is that of fitness and exercise. Advagym, Sony's connected gym solution is currently employing IoT solutions to track exercises in a gym environment. Together with Sony's R\&D Center Lund Laboratory's computer vision- and machine learning-equipped tracking system -

Prostate-specific antigen (PSA) has been the main drive for early detection of prostate cancer (PCa), including in population-based screening as in the European Randomised Study for Screening of Prostate Cancer (ERSPC). The specificity of PSA to indicate men with biopsy detectable prostate cancer can be improved by adding information obtained by new biomarkers, such as PSA isoforms. This improveme

In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES). In doing so, smooth mesoporous nanoparticles were compared to virus-like mesoporous nanoparticles, characterized by a "spiky"external surface, as well as to nonporous silica nanoparticles. For this, we employed a combinat