Search results

Forskningsområdet studerar organiseringen av välfärdspraktiker och de aktörer som verkar där, som professionella, men också som klienter, brukare, volontärer, besökare och liknande. Fokus ligger på det sociala arbetet och dess organisationer. Forskningen bygger därmed vidare på en tradition vid Socialhögskolan i Lund att kritiskt granska institutioner och institutionalisering. Området studerar ockThe research area studies the organization of welfare practitioners and the actors who work there, as professionals, but also as clients, users, volunteers and visitors, with focus on social work and its organizations. The research is thus based on a tradition at the Lund University to critically examine institutions and institutionalization. The area also studies professions, professionalization,

https://www.geologi.lu.se/service/pollen-tablets - 2026-05-13

Skissernas Museum – Museum of Artistic Process and Public Art är ett unikt konstmuseum med fokus på den konstnärliga kreativa processen. Här finns världens största samling av skisser, modeller och förlagor till svensk och internationell offentlig konst. I de stora utställningssalarna möts modern och samtida konst – från små blyertsteckningar till färgrika monumentala målningar och storskaliga gipsSkissernas Museum – Museum of Artistic Process and Public Art is a unique art museum that focuses on the artistic creative process. It features the world’s largest collection of sketches, models and preparatory work for Swedish and international public art. The large exhibition rooms hold modern and contemporary art – from small pencil drawings to colourful, monumental paintings and large-scale pl

0731PDF_Computational modeling strategy of steel connections Master’s Dissertation Structural Mechanics Report TV SM -5235 C A RL-M IC H A EL BJÄ LKEN SÄTER and C A RL H O LM G REN C O M PU TA TIO N A L M O D ELIN G STR A TEG Y O F STEEL C O N N EC TIO N S CARL-MICHAEL BJÄLKENSÄTER and CARL HOLMGREN COMPUTATIONAL MODELING STRATEGY OF STEEL CONNECTIONS 5235HO.indd 15235HO.indd 1 2019-08-08 20:50:53

https://www.byggmek.lth.se/fileadmin/byggnadsmekanik/publications/tvsm5000/web5235.pdf - 2026-05-11

Ämnet Urban design och urbanism handlar om undervisning och forskning som rör stadsplanering och utformning av det offentliga rummet, där ämnet vill verka för en hållbar utveckling. Här ingår bland annat lärare från Masterprogram för hållbar stadsgestaltning (SUDes). Forskningen inom ämnet handlar framför allt om studier av stadsrummet och dess möjligheter. Vidare studeras frågor om social segreThe subject of Urban Design and Urbanism is concerned with teaching and research about city planning and the shaping of the public realm, with a focus on sustainable development. Members of staff from the Master's programme for Sustainable Urban Design are among those who teach on the subject. Research in the subject is primarily concerned with studies of urban spaces and their potential. Additi

In 2009, a nationwide initiative was established in order to lead and develop world-leading research in Sweden. Lund University received strategic research funding from the Swedish Foundation for Stategic Research and the Swedish Government for 12 strategic research areas (SRAs) of excellence. Of these 12 SRAs, StemTherapy (the strategic research area for Stem Cells and Regenerative Medicine) cont

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

The Urban Systems and Dynamics group, led by Prof. Nik, advances the boundaries of Building Physics to explore the complex interactions between buildings, urban systems, and climate. Our research focuses on designing and optimizing strategies for buildings and urban systems (with a big focus on energy systems) that drive the sustainable urban transition and enhance the built environment's resilien

Forskningen bedrivs vid avdelningen för infektionsmedicin på BMC i nära samarbete med avdelningen för reumatologi och fokuserar kring nya mekanismer hos neutrofiler (en slags vita blodkroppar) som kan förklara eller prognosticera infektionssjukdom eller infektionskänslighet. Projekten drivs både som translationella studier där vi försöker förklara mekanismerna varför infektionssjukdom uppträder hoOur research is conducted at the division of infection medicine at BMC in close collaboration with the division of rheumatology. The research is focused on new neutrophil mechanisms that can explain or prognosticate infectious diseases. The approach to the projects is either translational, where we try to explain why certain individuals turn ill due to infections, or more clinically focused, where