Search results

Filter

Filetype

Your search for "Cheap fc coins Buyfc26coins.com is EA Sports official for FC 26 coins Immediate delivery and great service provided..YEy1" yielded 56312 hits

0731PDF_Computational modeling strategy of steel connections

0731PDF_Computational modeling strategy of steel connections Master’s Dissertation Structural Mechanics Report TV SM -5235 C A RL-M IC H A EL BJÄ LKEN SÄTER and C A RL H O LM G REN C O M PU TA TIO N A L M O D ELIN G STR A TEG Y O F STEEL C O N N EC TIO N S CARL-MICHAEL BJÄLKENSÄTER and CARL HOLMGREN COMPUTATIONAL MODELING STRATEGY OF STEEL CONNECTIONS 5235HO.indd 15235HO.indd 1 2019-08-08 20:50:53

https://www.byggmek.lth.se/fileadmin/byggnadsmekanik/publications/tvsm5000/web5235.pdf - 2026-05-04

Urban design och urbanism

Ämnet Urban design och urbanism handlar om undervisning och forskning som rör stadsplanering och utformning av det offentliga rummet, där ämnet vill verka för en hållbar utveckling. Här ingår bland annat lärare från Masterprogram för hållbar stadsgestaltning (SUDes). Forskningen inom ämnet handlar framför allt om studier av stadsrummet och dess möjligheter. Vidare studeras frågor om social segreThe subject of Urban Design and Urbanism is concerned with teaching and research about city planning and the shaping of the public realm, with a focus on sustainable development. Members of staff from the Master's programme for Sustainable Urban Design are among those who teach on the subject. Research in the subject is primarily concerned with studies of urban spaces and their potential. Additi

StemTherapy: National Initiative on Stem Cells for Regenerative Therapy

In 2009, a nationwide initiative was established in order to lead and develop world-leading research in Sweden. Lund University received strategic research funding from the Swedish Foundation for Stategic Research and the Swedish Government for 12 strategic research areas (SRAs) of excellence. Of these 12 SRAs, StemTherapy (the strategic research area for Stem Cells and Regenerative Medicine) cont

Bactericidal and hemolytic properties of mixed LL-37/surfactant systems

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

Neutrofiler – nya mekanismer och nya markörer

Forskningen bedrivs vid avdelningen för infektionsmedicin på BMC i nära samarbete med avdelningen för reumatologi och fokuserar kring nya mekanismer hos neutrofiler (en slags vita blodkroppar) som kan förklara eller prognosticera infektionssjukdom eller infektionskänslighet. Projekten drivs både som translationella studier där vi försöker förklara mekanismerna varför infektionssjukdom uppträder hoOur research is conducted at the division of infection medicine at BMC in close collaboration with the division of rheumatology. The research is focused on new neutrophil mechanisms that can explain or prognosticate infectious diseases. The approach to the projects is either translational, where we try to explain why certain individuals turn ill due to infections, or more clinically focused, where

Urbana System och Dynamik (USD)

The Urban Systems and Dynamics group, led by Prof. Nik, advances the boundaries of Building Physics to explore the complex interactions between buildings, urban systems, and climate. Our research focuses on designing and optimizing strategies for buildings and urban systems (with a big focus on energy systems) that drive the sustainable urban transition and enhance the built environment's resilien

Inresande forskningspraktikanter

20191022 Inresande forskningspraktikanter (grund- eller masterstudenter) Den internationella kommittén vid Institutionen för psykologi har beslutat om riktlinjer för att skapa bra förutsättningar för ett ömsesidigt givande forskningssamarbete mellan inkommande forskningspraktikanter samt ansvariga forskare. Då du som forskare blir kontaktad av internationella studenter som önskar delta i ett forsk

https://www.psy.lu.se/sites/psy.lu.se/files/inresande_forskningspraktikanter.pdf - 2026-05-06

Tissue temperature monitoring during interstitial photodynamic therapy

During δ-aminolevulinic acid (ALA) based Interstitial Photodynamic Therapy (IPDT) a high light fluence rate is present close to the source fibers. This might induce an unintentional tissue temperature increase of importance for the treatment outcome. In a previous study, we have observed, that the absorption in the tissue increases during the treatment. A system to measure the local tissue tempera

Star Stable: En fälla för barn? En studie kring Star Stables marknadsföring gentemot barn och dess förenlighet med EU:s konsumentskyddslagstiftning

Uppsatsen har undersökt huruvida spelföretaget Star Stable Entertainment AB marknadsföring av virtuella valutor och produkter till barn bryter mot EU:s konsumentskyddslagstiftning i ljuset av Sveriges Konsumenters anmälan mot företaget. Uppsatsen har även diskuterat om direktivet om otillbörliga affärs-metoder är anpassat för den digitala miljön med hänsyn till kommissionens aktuella fitness checkThe essay analyses whether the gaming company Star Stable Entertainment AB´s marketing of virtual currencies and other virtual products against chil-dren violates EU consumer law, considering the Swedish Consumers Associ-ation’s complaint against the company. The paper also discusses whether the Unfair Commercial Practice Directive (UCPD) is fit for the digital environ-ment, given the European Com

Stab

Staben samordnar och utvecklar Lunds universitetets ekonomimodell, förvaltar och utvecklar de IT-system som sektionen Ekonomi ansvarar för. Samordnar och utvecklar sektionens stöd i form av utbildning, information och support. Utvecklar och ansvarar för konsolidering av universitetets totalbudget samt ekonomiska uppföljning och analys. Ger stöd och råd i budget och uppföljningsfrågor. Leder och u