Search results

Filter

Filetype

Your search for "Cheap fc coins Buyfc26coins.com is EA Sports official for FC 26 coins Immediate delivery and great service provided..UfY9" yielded 71805 hits

Skissernas Museum

Skissernas Museum – Museum of Artistic Process and Public Art är ett unikt konstmuseum med fokus på den konstnärliga kreativa processen. Här finns världens största samling av skisser, modeller och förlagor till svensk och internationell offentlig konst. I de stora utställningssalarna möts modern och samtida konst – från små blyertsteckningar till färgrika monumentala målningar och storskaliga gipsSkissernas Museum – Museum of Artistic Process and Public Art is a unique art museum that focuses on the artistic creative process. It features the world’s largest collection of sketches, models and preparatory work for Swedish and international public art. The large exhibition rooms hold modern and contemporary art – from small pencil drawings to colourful, monumental paintings and large-scale pl

Professioner och organisering

Forskningsområdet studerar organiseringen av välfärdspraktiker och de aktörer som verkar där, som professionella, men också som klienter, brukare, volontärer, besökare och liknande. Fokus ligger på det sociala arbetet och dess organisationer. Forskningen bygger därmed vidare på en tradition vid Socialhögskolan i Lund att kritiskt granska institutioner och institutionalisering. Området studerar ockThe research area studies the organization of welfare practitioners and the actors who work there, as professionals, but also as clients, users, volunteers and visitors, with focus on social work and its organizations. The research is thus based on a tradition at the Lund University to critically examine institutions and institutionalization. The area also studies professions, professionalization,

No title

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

No title

This study investigates the manufacturing and application of enteric polymeric microneedles loaded with active pharmaceutical ingredients and combined with photoresponsive dyes used for micromotor motion. The aim is to present an alternative method for orally delivering macromolecules. Although needle fear among patients has led to investigations into alternative routes of administration for macro

Urban design och urbanism

Ämnet Urban design och urbanism handlar om undervisning och forskning som rör stadsplanering och utformning av det offentliga rummet, där ämnet vill verka för en hållbar utveckling. Här ingår bland annat lärare från Masterprogram för hållbar stadsgestaltning (SUDes). Forskningen inom ämnet handlar framför allt om studier av stadsrummet och dess möjligheter. Vidare studeras frågor om social segreThe subject of Urban Design and Urbanism is concerned with teaching and research about city planning and the shaping of the public realm, with a focus on sustainable development. Members of staff from the Master's programme for Sustainable Urban Design are among those who teach on the subject. Research in the subject is primarily concerned with studies of urban spaces and their potential. Additi

StemTherapy: National Initiative on Stem Cells for Regenerative Therapy

In 2009, a nationwide initiative was established in order to lead and develop world-leading research in Sweden. Lund University received strategic research funding from the Swedish Foundation for Stategic Research and the Swedish Government for 12 strategic research areas (SRAs) of excellence. Of these 12 SRAs, StemTherapy (the strategic research area for Stem Cells and Regenerative Medicine) cont

No title

Protease-responsive multi-arm polyethylene glycol-based microparticles with biscysteine peptide crosslinkers (CGPGG↓LAGGC) were obtained for intradermal drug delivery through inverse suspension photopolymerization. The average size of the spherical hydrated microparticles was ∼40 μm after crosslinking, making them attractive as a skin depot and suitable for intradermal injections, as they are read

No title

A new encapsulation strategy for probiotics is highly needed to tackle the challenge of significant viability loss of bacteria during storage and passage through the gastrointestinal system. A new controlled delivery system for probiotics based on EC oleogels is proposed in this thesis. A relatively non-complicated in vitro lipolysis model was established to evaluate the relative conversion from t

Programvaruteknik

SDE at Lund University conducts research on the development of new tools, languages, and methods for software development. Example areas include compilers, program analysis, domain-specific languages and tools, meta-programming tools, integrated development environments, code review tools, adaptive developer tools, agile methodology, software architecture and design, pervasive systems, internet-of